BetaJoin our early access program — 1 year free for founding members.Apply Now →

Blog

Google Workspace Tips & Guides

Practical guides for IT admins managing Google Workspace — offboarding, compliance, group management, and more.

5 min read

Domain-Wide Delegation in Google Workspace™: Powerful, Dangerous, and Often Misunderstood

Domain-wide delegation lets a service account impersonate any user in your domain. Here's what it actually allows, where the real risk lives, and the four questions to ask about every DWD grant.

domain-wide-delegationservice-accountsgoogle-workspacesecurityoauth
7 min read

MonitorWorkspace Receives TX-RAMP Provisional Certification from Texas DIR

MonitorWorkspace has been granted TX-RAMP provisional certification by the Texas Department of Information Resources, allowing Texas state agencies to contract for Google Workspace governance and monitoring tooling immediately.

announcementsecuritycompliancegovernmenttexastx-rampit-admin
4 min read

How to Give Your Helpdesk the Right Level of Google Workspace Access

Delegate scoped IT support access in Google Workspace — what the IT Support role can see, what it can't, and why that boundary matters for governance.

google-workspaceit-supportaccess-controlsecurityoffboarding
4 min read

What Your Google Workspace Admin Can See Without Reading a Single Email

Gmail governance gives IT admins visibility into forwarding rules, delegates, and risky filters — without accessing inbox content. And now your helpdesk can run these checks too.

gmail-governancegoogle-workspacecomplianceIT-adminit-support
5 min read

The OAuth Grants Your Google Workspace Org Forgot About

Every 'Sign in with Google' creates a persistent token. Most orgs have never seen the full list. Here's how to audit connected apps and reduce your OAuth attack surface.

google-workspaceoauthsecurityconnected-appsshadow-itcompliance
4 min read

Login Geography in Google Workspace: The Security Signal Most Admins Never See

Google Workspace logs every sign-in with city, country, and IP. Most orgs never review it systematically. Here's how location-based security review actually works.

google-workspacesecuritylogin-monitoringaccess-controlit-support
5 min read

The Suspension Gate: Why IT Support Can't Run Migrations on Active Accounts

Before an IT support user can migrate or transfer data in MonitorWorkspace, the account must be suspended. Here's why that's a governance feature, not a limitation.

google-workspaceoffboardingit-supportdata-migrationgovernance
4 min read

MonitorWorkspace Achieves CASA Certification

MonitorWorkspace has completed the Cloud Application Security Assessment (CASA) — an independent security review required for apps that access sensitive Google Workspace data.

announcementsecuritycompliancegoogle-workspaceit-admin
3 min read

MonitorWorkspace Is Now a Google-Verified OAuth App

Google's Third Party Data Safety Team has approved MonitorWorkspace for all 14 requested OAuth scopes. Here is what that means for your organization.

announcementgoogle-workspacesecurityoauthit-admin
6 min read

Google Workspace Intelligence Is Default On — What Admins Need to Know

Starting April 22, 2026, Google's Workspace Intelligence — which grounds Gemini on your org's Gmail, Drive, Chat, and Calendar data — is enabled by default for all users. Here's what changed and what to check.

google-workspacegeminiai-agentssecuritycomplianceit-admin
6 min read

Google Workspace MCP Servers Are Here — What IT Admins Need to Know

Google just launched MCP servers for Gmail™, Drive, Calendar, Chat, and People API. Here's what that means for your organization's security posture and what to audit right now.

google-workspaceai-agentsmcpsecuritycomplianceit-admin
3 min read

Lokentra at the 2026 Missouri K-12 Leadership Conference

Lokentra is attending the Missouri K-12 Leadership Conference in April 2026 with Platinum Partner BuzzClan. Here is what we are showing — a RAG-powered district chatbot and Google Workspace management built for K-12 IT teams.

announcementeducationk12conferencegoogle-workspaceai
4 min read

We Scanned 556 Missouri School District Websites. Here Is What We Found.

Before attending the Missouri K-12 Leadership Conference, we analyzed every public school district website in the state. The findings shaped what we built and what we are bringing to the booth.

educationk12researchgoogle-workspaceaisled
6 min read

Gmail Governance Without Inbox Browsing — What IT Admins Can See Without Reading Email

Audit Gmail forwarding rules, delegates, and risky mail filters across your Google Workspace domain without accessing inbox content. A governance-first approach to email security.

gmail-governanceemail-securitycompliancegoogle-workspace
8 min read

Service Accounts in Google Workspace: Vendor vs Customer-Owned Security Explained

Service accounts explained through a door card analogy. Understand the security difference between vendor-provided and customer-owned service accounts in Google Workspace integrations.

service-accountsgoogle-workspacesecurityarchitecture
5 min read

We Analyzed 229,000 U.S. Micro-Nonprofits. The Infrastructure Gap Is Worse Than the Security Gap.

We analyzed 229,829 IRS 990-N filers and DNS-checked 208,078 domains. 30.7% have no email infrastructure. Google Workspace dominates at 27.1%. Office 365 holds 11.2%. Platform share hasn't moved in five years.

nonprofitsemail-securitygoogle-workspacedmarcdata-analysisinfrastructure
2 min read

229,000 Micro-Nonprofits, 208,000 Domains: Key Findings

The short version: we analyzed IRS 990-N data for every active micro-nonprofit in the U.S. Here are the five numbers that matter.

nonprofitsemail-securitygoogle-workspacedata-analysis
6 min read

What Is DMARC? A Plain-Language Guide for Nonprofit Board Members

DMARC stops people from sending fake emails that look like they come from your organization. Here's what it is, why your nonprofit needs it, and how to set it up — no IT background required.

nonprofitsemail-securitydmarcboard-governancehow-to
9 min read

Why MonitorWorkspace — For Every Team, Every Role, Every Scale

Google Workspace admin pain looks different depending on your team size and role. Here's how MonitorWorkspace solves it — whether you're a solo admin, a reseller, or an MSP managing dozens of domains.

google-workspaceit-adminoffboardingproductmspreseller
9 min read

Automated Compliance Reporting for Google Workspace

Manual compliance reports from Google Admin Console take hours and go stale instantly. Here's how to automate user access, admin role, and group health reporting.

google-workspacecomplianceautomated-reportingit-admin
7 min read

How to Run Periodic Access Reviews in Google Workspace

Quarterly access reviews catch privilege creep, stale accounts, and unauthorized access before auditors do. Here's how to run them in Google Workspace without losing your mind.

google-workspaceperiodic-access-reviewscompliancesecurity
8 min read

GAM vs. MonitorWorkspace: Two Ways to Fix What the Admin Console Can't Do

GAM is the command-line tool that tens of thousands of Workspace admins rely on. MonitorWorkspace is a web dashboard that solves the same problems without scripting. Here's when to use each.

google-workspacegamit-admincomparisontools
9 min read

Google Workspace for Nonprofits: The Admin Guide Nobody Gave You

Google gives nonprofits free Workspace. What they don't give you is a guide to actually managing it. Here's everything the setup wizard skips.

google-workspacenonprofitsit-adminadmin-guide
8 min read

What Happens When Your Nonprofit Loses Its Super Admin

The founder left. The board rotated. Nobody knows the super admin password. This is the most common Google Workspace crisis for nonprofits — here's how to fix it and prevent it.

google-workspacenonprofitssuper-admindisaster-recovery
8 min read

Volunteer Offboarding Checklist for Google Workspace

Volunteers leave faster than employees. Without a proper offboarding process, your Google Workspace fills up with ghost accounts, stale group memberships, and orphaned files.

offboardinggoogle-workspacenonprofitsvolunteersit-admin
12 min read

Google Workspace Employee Monitoring for HR: Compliance, Legal Frameworks, and Tools

How to set up Google Workspace employee monitoring for HR investigations, periodic access reviews, and compliance auditing — legal frameworks, tools, and best practices for IT admins.

google-workspaceemployee-monitoringhr-monitoringcomplianceperiodic-access-reviews
12 min read

Google Workspace Monitoring Software: The Complete Guide for IT Admins

The complete guide to Google Workspace monitoring software — user monitoring, employee activity tracking, real-time compliance dashboards, and admin audit tools for IT teams.

google-workspacemonitoring-softwareuser-monitoringemployee-monitoringcompliance
6 min read

Stop Exporting to Google Sheets Just to Manage Your Users

Google Admin Console can't sort, filter, or summarize your user list. So every admin exports to Sheets. There's a better way.

google-workspaceuser-managementit-adminproductivity
5 min read

Who Has Admin Access? How to Audit Google Workspace Roles

Most organizations can't answer who has admin access and why. Here's how to audit every role assignment in Google Workspace and fix privilege creep.

admin-rolessecuritygoogle-workspacecompliance
5 min read

Preview Email Transfers Before They Run — Dry Runs and Smarter Filters

New dry run estimates let you see exactly how many emails will transfer before committing. Plus smarter filters to skip newsletters, duplicates, and noise.

email-transferoffboardinggoogle-workspaceit-admin
8 min read

Email Monitoring in Google Workspace — What IT Admins Actually Need

When and how to monitor employee email in Google Workspace. Covers legal frameworks, native tools, audit requirements, and transparent monitoring practices.

email-monitoringcompliancegoogle-workspacesecurity
5 min read

MonitorWorkspace Beta Program — 1 Year Free for Founding Members

Join the MonitorWorkspace beta and get 12 months of free access to Google Workspace monitoring, email transfers, and chat exports. Here is what to expect.

betagoogle-workspaceannouncementit-admin
9 min read

How to Find and Reclaim Unused Google Workspace Licenses

A practical guide to auditing Google Workspace license assignments, spotting waste, and reclaiming unused seats to reduce your monthly bill.

license-optimizationgoogle-workspacecost-savingsit-admin
7 min read

The Complete Google Workspace Offboarding Checklist

Step-by-step guide to offboarding employees from Google Workspace — email transfers, chat exports, group cleanup, and license reclamation.

offboardinggoogle-workspaceit-admincompliance
10 min read

How to Export Google Chat Messages for Compliance

How to export Google Chat messages for compliance, legal holds, and audits. Compares native tools, API methods, and third-party solutions.

google-chatcompliancedata-exportlegal
8 min read

Google Groups Are a Mess — Here’s How to Fix Them

Most Google Workspace domains have stale groups, orphaned members, and security risks. Here’s how to audit, clean up, and automate group management.

google-groupssecuritygoogle-workspaceautomation

Google Workspace™, Gmail™, Google Chat™, Google Drive™, Google Groups™, and Google Vault™ are trademarks of Google LLC. MonitorWorkspace is not affiliated with or endorsed by Google LLC.